PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_16789_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 396aa    MW: 43726.4 Da    PI: 7.0532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_16789_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.2e-1853100148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           rg+WT+eEdell++++k+ G g+W+t +++ g+ R++k+c++rw +yl
  cra_locus_16789_iso_1_len_1282_ver_3  53 RGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRWMNYL 100
                                           89******************************99************97 PP

2Myb_DNA-binding46.39.5e-15111151648
                                           HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  cra_locus_16789_iso_1_len_1282_ver_3 111 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 151
                                           89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-2244102IPR009057Homeodomain-like
PROSITE profilePS5129416.09648100IPR017930Myb domain
SuperFamilySSF466891.47E-2850147IPR009057Homeodomain-like
SMARTSM007173.2E-1352102IPR001005SANT/Myb domain
PfamPF002491.4E-1553100IPR001005SANT/Myb domain
CDDcd001671.39E-1055100No hitNo description
PROSITE profilePS5129424.404101155IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-24103156IPR009057Homeodomain-like
SMARTSM007171.2E-13105153IPR001005SANT/Myb domain
CDDcd001675.86E-11111151No hitNo description
PfamPF002491.6E-13111151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MRKPSSRTTQ AAAAVGGGDG GGGASSSSAA AVAANNNNNN KVTPCCNKIG LKRGPWTPEE  60
DELLANYIKR EGEGRWRTLP KKAGLLRCGK SCRLRWMNYL RPSVKRGHIA PDEEDLILRL  120
HRLLGNRWSL IAGRIPGRTD NEIKNYWNTH LSKKLISQGI DPRTHKPLPI QQPPPPPPPP  180
ITSINSPIIQ NSNILPNQIQ VPTTSNSNYI PNNNSLLEFD QVPALNYQTC LTQLVDHENG  240
NMDNNNNISM IQNGAAAAVG VGGGAGESCY EGQISNEDDQ EQDDMNYCTN DDVFSSFLNS  300
LINEDVFNSQ NHLVQLHQQH HHQPHQQHSM INVVDQNNDH HHLISSSSSS TQAFAFGPAA  360
GWDHHHASQN MIMAANPTAA FHHHHQNDHQ VEKPHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25511555108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295005.11e-102PREDICTED: transcription repressor MYB5
TrEMBLQ6Q7891e-101Q6Q789_VITVI; Myb transcription factor
STRINGVIT_08s0007g07230.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154